SCOPe 2.06: Domain d2uyyd1: 2uyy D:263-429

Lineage for d2uyyd1 (2uyy D:263-429)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d2uyyd1: 2uyy D:263-429 [231293]
   Other proteins in same PDB: d2uyya2, d2uyyb2, d2uyyc2, d2uyyd2
   automated match to d3ckyd1
   complexed with k, na7

Details for d2uyyd1

PDB Entry: 2uyy, 2.5 Å

PDB Description: structure of the cytokine-like nuclear factor n-pac

PDB Compounds: (D:) n-pac protein

SCOPe Domain Sequences for d2uyyd1:

Sequence; same for both SEQRES and ATOM records:

>d2uyyd1 c.2.1.0 (D:263-429) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevvs
tcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggrf
leapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflge

Timeline for d2uyyd1:

• d2uyyd1 first appeared in SCOPe 2.03
  
• d2uyyd1 appears in SCOPe 2.05
  
• d2uyyd1 appears in SCOPe 2.07
  
• d2uyyd1 appears in the current release, SCOPe 2.08