Lineage for d2uyyd1 (2uyy D:263-429)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580813Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries)
  8. 1580859Domain d2uyyd1: 2uyy D:263-429 [231293]
    Other proteins in same PDB: d2uyya2, d2uyyb2, d2uyyc2, d2uyyd2
    automated match to d3ckyd1
    complexed with k, na7

Details for d2uyyd1

PDB Entry: 2uyy (more details), 2.5 Å

PDB Description: structure of the cytokine-like nuclear factor n-pac
PDB Compounds: (D:) n-pac protein

SCOPe Domain Sequences for d2uyyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyyd1 c.2.1.0 (D:263-429) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itptdkkigflglglmgsgivsnllkmghtvtvwnrtaekcdlfiqegarlgrtpaevvs
tcditfacvsdpkaakdlvlgpsgvlqgirpgkcyvdmstvdadtvtelaqvivsrggrf
leapvsgnqqlsndgmlvilaagdrglyedcsscfqamgktsfflge

SCOPe Domain Coordinates for d2uyyd1:

Click to download the PDB-style file with coordinates for d2uyyd1.
(The format of our PDB-style files is described here.)

Timeline for d2uyyd1: