Lineage for d2rdxf1 (2rdx F:0-127)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649638Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 1649652Domain d2rdxf1: 2rdx F:0-127 [231273]
    Other proteins in same PDB: d2rdxa2, d2rdxb2, d2rdxc2, d2rdxd2, d2rdxe2, d2rdxg2, d2rdxh2
    automated match to d4mggf1
    complexed with gol, mg

Details for d2rdxf1

PDB Entry: 2rdx (more details), 2 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
PDB Compounds: (F:) Mandelate racemase/muconate lactonizing enzyme, putative

SCOPe Domain Sequences for d2rdxf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdxf1 d.54.1.0 (F:0-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
slritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymi
ahsegvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgq
pvwmllgg

SCOPe Domain Coordinates for d2rdxf1:

Click to download the PDB-style file with coordinates for d2rdxf1.
(The format of our PDB-style files is described here.)

Timeline for d2rdxf1: