SCOPe 2.05: Domain d2rdxd2: 2rdx D:128-368

Lineage for d2rdxd2 (2rdx D:128-368)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries)

8. Domain d2rdxd2: 2rdx D:128-368 [231268]
   Other proteins in same PDB: d2rdxa1, d2rdxb1, d2rdxc1, d2rdxd1, d2rdxe1, d2rdxf1, d2rdxg1, d2rdxh1
   automated match to d4mggf2
   complexed with gol, mg

Details for d2rdxd2

PDB Entry: 2rdx, 2 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme, putative

SCOPe Domain Sequences for d2rdxd2:

Sequence; same for both SEQRES and ATOM records:

>d2rdxd2 c.1.11.0 (D:128-368) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
klcdgapmyrvapqrseaetraelarhraagyrqfqikvgadwqsdidriraclpllepg
ekamadanqgwrvdnairlaratrdldyileqpcrsyeecqqvrrvadqpmkldecvtgl
hmaqrivadrgaeicclkisnlgglskarrtrdflidnrmpvvaedswggeiasaavahf
aastpeeflinstdlmnyntrstglggptvhqgrlyasdtpglgvtpdfnslgapvadwa
l

Timeline for d2rdxd2:

• d2rdxd2 first appeared in SCOPe 2.03
  
• d2rdxd2 appears in SCOPe 2.04
  
• d2rdxd2 appears in SCOPe 2.06
  
• d2rdxd2 appears in the current release, SCOPe 2.08