Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries) |
Domain d2rdxc1: 2rdx C:2-127 [231265] Other proteins in same PDB: d2rdxa2, d2rdxa3, d2rdxb2, d2rdxb3, d2rdxc2, d2rdxc3, d2rdxd2, d2rdxd3, d2rdxe2, d2rdxe3, d2rdxe4, d2rdxf2, d2rdxg2, d2rdxg3, d2rdxh2, d2rdxh3 automated match to d4mggf1 complexed with gol, mg |
PDB Entry: 2rdx (more details), 2 Å
SCOPe Domain Sequences for d2rdxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdxc1 d.54.1.0 (C:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} ritrirlyktdlpyvdgsygwgagnaitvarasvvvidtdaglqgcgeftpcgenymiah segvdafarlaapqllgqdprqvarmerlmdhlvqghgyakapfdaafwdilgqatgqpv wmllgg
Timeline for d2rdxc1: