Lineage for d1aoza3 (1aoz A:339-552)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11162Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 11163Protein Ascorbate oxidase [49555] (1 species)
  7. 11164Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)
  8. 11167Domain d1aoza3: 1aoz A:339-552 [23126]

Details for d1aoza3

PDB Entry: 1aoz (more details), 1.9 Å

PDB Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution

SCOP Domain Sequences for d1aoza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

SCOP Domain Coordinates for d1aoza3:

Click to download the PDB-style file with coordinates for d1aoza3.
(The format of our PDB-style files is described here.)

Timeline for d1aoza3: