SCOPe 2.08: Domain d2rdha2: 2rdh A:94-196

Lineage for d2rdha2 (2rdh A:94-196)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)

8. Domain d2rdha2: 2rdh A:94-196 [231255]
   Other proteins in same PDB: d2rdha1, d2rdhb1, d2rdhc1, d2rdhd1
   automated match to d3o13a2
   complexed with na, po4

Details for d2rdha2

PDB Entry: 2rdh, 1.7 Å

PDB Description: Crystal structure of Staphylococcal Superantigen-Like protein 11

PDB Compounds: (A:) Superantigen-like protein 11

SCOPe Domain Sequences for d2rdha2:

Sequence; same for both SEQRES and ATOM records:

>d2rdha2 d.15.6.0 (A:94-196) automated matches {Staphylococcus aureus [TaxId: 1280]}
hidtvqnvnllvskstgqhttsvtstnysiykeeislkeldfklrkhlidkhdlyktepk
dskirvtmkngdfytfelnkklqthrmgdvidgrniekievnl

Timeline for d2rdha2:

• d2rdha2 first appeared in SCOPe 2.03
  
• d2rdha2 appears in SCOPe 2.07