Lineage for d2rdha1 (2rdh A:6-93)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398788Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2398789Protein automated matches [226834] (6 species)
    not a true protein
  7. 2398790Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)
  8. 2398793Domain d2rdha1: 2rdh A:6-93 [231253]
    Other proteins in same PDB: d2rdha2, d2rdhb2, d2rdhc2, d2rdhd2
    automated match to d3o13a1
    complexed with na, po4

Details for d2rdha1

PDB Entry: 2rdh (more details), 1.7 Å

PDB Description: Crystal structure of Staphylococcal Superantigen-Like protein 11
PDB Compounds: (A:) Superantigen-like protein 11

SCOPe Domain Sequences for d2rdha1:

Sequence, based on SEQRES records: (download)

>d2rdha1 b.40.2.0 (A:6-93) automated matches {Staphylococcus aureus [TaxId: 1280]}
rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
dvfvvregsgrqadnnsiggitktnrtq

Sequence, based on observed residues (ATOM records): (download)

>d2rdha1 b.40.2.0 (A:6-93) automated matches {Staphylococcus aureus [TaxId: 1280]}
rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
dvfvvrednnsiggitktnrtq

SCOPe Domain Coordinates for d2rdha1:

Click to download the PDB-style file with coordinates for d2rdha1.
(The format of our PDB-style files is described here.)

Timeline for d2rdha1: