SCOPe 2.05: Domain d2rdha1: 2rdh A:6-93

Lineage for d2rdha1 (2rdh A:6-93)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (7 PDB entries)

8. Domain d2rdha1: 2rdh A:6-93 [231253]
   Other proteins in same PDB: d2rdha2, d2rdhb2, d2rdhc2, d2rdhd2
   automated match to d3o13a1
   complexed with na, po4

Details for d2rdha1

PDB Entry: 2rdh, 1.7 Å

PDB Description: Crystal structure of Staphylococcal Superantigen-Like protein 11

PDB Compounds: (A:) Superantigen-like protein 11

SCOPe Domain Sequences for d2rdha1:

Sequence, based on SEQRES records:

>d2rdha1 b.40.2.0 (A:6-93) automated matches {Staphylococcus aureus [TaxId: 1280]}
rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
dvfvvregsgrqadnnsiggitktnrtq

Sequence, based on observed residues (ATOM records):

>d2rdha1 b.40.2.0 (A:6-93) automated matches {Staphylococcus aureus [TaxId: 1280]}
rsqatqdlseyynrpyfdlrnlsgyregntvtfinhyqqtdvklegkdkdkikdgnnenl
dvfvvrednnsiggitktnrtq

Timeline for d2rdha1:

• d2rdha1 first appeared in SCOPe 2.03
  
• d2rdha1 appears in SCOPe 2.04
  
• d2rdha1 appears in SCOPe 2.06
  
• d2rdha1 appears in the current release, SCOPe 2.08