Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (54 species) not a true protein |
Species Silicibacter pomeroyi [TaxId:246200] [231231] (1 PDB entry) |
Domain d2qsjb_: 2qsj B: [231233] automated match to d3crna_ |
PDB Entry: 2qsj (more details), 2.1 Å
SCOPe Domain Sequences for d2qsjb_:
Sequence, based on SEQRES records: (download)
>d2qsjb_ c.23.1.0 (B:) automated matches {Silicibacter pomeroyi [TaxId: 246200]} ltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnlpd aeaidglvrlkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavslil egeiflprsy
>d2qsjb_ c.23.1.0 (B:) automated matches {Silicibacter pomeroyi [TaxId: 246200]} ltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvaidg lvrlkrfdpsnavalisgeheliraaleagadgfipksadpqvlihavslilegeiflpr sy
Timeline for d2qsjb_: