Lineage for d2qsja_ (2qsj A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1587002Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1587003Protein automated matches [190131] (54 species)
    not a true protein
  7. 1587183Species Silicibacter pomeroyi [TaxId:246200] [231231] (1 PDB entry)
  8. 1587184Domain d2qsja_: 2qsj A: [231232]
    automated match to d3crna_

Details for d2qsja_

PDB Entry: 2qsj (more details), 2.1 Å

PDB Description: crystal structure of a luxr family dna-binding response regulator from silicibacter pomeroyi
PDB Compounds: (A:) DNA-binding response regulator, LuxR family

SCOPe Domain Sequences for d2qsja_:

Sequence, based on SEQRES records: (download)

>d2qsja_ c.23.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
ltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnlpd
aeaidglvrlkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavslil
egeiflprsyl

Sequence, based on observed residues (ATOM records): (download)

>d2qsja_ c.23.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
ltvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvaidg
lvrlkrfdpsnavaliheliraaleagadgfipksadpqvlihavslilegeiflprsyl

SCOPe Domain Coordinates for d2qsja_:

Click to download the PDB-style file with coordinates for d2qsja_.
(The format of our PDB-style files is described here.)

Timeline for d2qsja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qsjb_