Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries) |
Domain d2qdda2: 2qdd A:128-369 [231200] Other proteins in same PDB: d2qdda1, d2qddb1 automated match to d3eeza2 complexed with gol |
PDB Entry: 2qdd (more details), 2.3 Å
SCOPe Domain Sequences for d2qdda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdda2 c.1.11.0 (A:128-369) automated matches {Roseovarius nubinhibens [TaxId: 89187]} eaatpvpinssistgtpdqmlgliaeaaaqgyrthsakiggsdpaqdiarieaisaglpd ghrvtfdvnrawtpaiavevlnsvrardwieqpcqtldqcahvarrvanpimldeclhef sdhlaawsrgacegvkikpnrvggltrarqirdfgvsvgwqmhiedvggtaladtaalhl aastpeanrlaswlghahladdpipgqgarnrdglatppsapglgvipdpealgrpvasy de
Timeline for d2qdda2: