Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Lyngbya majuscula [TaxId:276768] [231186] (3 PDB entries) |
Domain d2q34a1: 2q34 A:17-257 [231188] Other proteins in same PDB: d2q34a2 automated match to d3fdua_ |
PDB Entry: 2q34 (more details), 1.85 Å
SCOPe Domain Sequences for d2q34a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q34a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]} vvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyfss gaskeylirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqesv yatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqdvl nyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriqqe f
Timeline for d2q34a1: