SCOPe 2.08: Domain d2q34a1: 2q34 A:17-257

Lineage for d2q34a1 (2q34 A:17-257)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Lyngbya majuscula [TaxId:276768] [231186] (3 PDB entries)

8. Domain d2q34a1: 2q34 A:17-257 [231188]
   Other proteins in same PDB: d2q34a2
   automated match to d3fdua_

Details for d2q34a1

PDB Entry: 2q34, 1.85 Å

PDB Description: crystal structure of the ech2 decarboxylase domain of curf from lyngbya majuscula, rhombohedral crystal form

PDB Compounds: (A:) CurF

SCOPe Domain Sequences for d2q34a1:

Sequence; same for both SEQRES and ATOM records:

>d2q34a1 c.14.1.0 (A:17-257) automated matches {Lyngbya majuscula [TaxId: 276768]}
vvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyfss
gaskeylirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqesv
yatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqdvl
nyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriqqe
f

Timeline for d2q34a1:

• d2q34a1 first appeared in SCOPe 2.03, called d2q34a_
  
• d2q34a1 appears in SCOPe 2.07