Lineage for d2pwyb_ (2pwy B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895081Species Thermus thermophilus [TaxId:262724] [231176] (3 PDB entries)
  8. 2895083Domain d2pwyb_: 2pwy B: [231178]
    automated match to d3lgaa_
    complexed with sah, so4

Details for d2pwyb_

PDB Entry: 2pwy (more details), 1.7 Å

PDB Description: Crystal Structure of a m1A58 tRNA methyltransferase
PDB Compounds: (B:) tRNA (adenine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d2pwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwyb_ c.66.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
gplllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptle
eyllhmkrsatptypkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesy
earphhlaqaernvrafwqvenvrfhlgkleeaeleeaaydgvaldlmepwkvlekaala
lkpdrflvaylpnitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghta
flvalrrwkg

SCOPe Domain Coordinates for d2pwyb_:

Click to download the PDB-style file with coordinates for d2pwyb_.
(The format of our PDB-style files is described here.)

Timeline for d2pwyb_: