SCOPe 2.06: Domain d2pwya_: 2pwy A:

Lineage for d2pwya_ (2pwy A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [231176] (3 PDB entries)

8. Domain d2pwya_: 2pwy A: [231177]
   automated match to d3lgaa_
   complexed with sah, so4

Details for d2pwya_

PDB Entry: 2pwy, 1.7 Å

PDB Description: Crystal Structure of a m1A58 tRNA methyltransferase

PDB Compounds: (A:) tRNA (adenine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d2pwya_:

Sequence; same for both SEQRES and ATOM records:

>d2pwya_ c.66.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
gplllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptle
eyllhmkrsatptypkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesy
earphhlaqaernvrafwqvenvrfhlgkleeaeleeaaydgvaldlmepwkvlekaala
lkpdrflvaylpnitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghta
flvalrrwkgs

Timeline for d2pwya_:

• d2pwya_ first appeared in SCOPe 2.03
  
• d2pwya_ appears in SCOPe 2.05
  
• d2pwya_ appears in SCOPe 2.07
  
• d2pwya_ appears in the current release, SCOPe 2.08