Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries) Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601 |
Domain d1ndsc2: 1nds C:167-340 [23117] CA-atoms only complexed with cu, no2 |
PDB Entry: 1nds (more details), 2.8 Å
SCOPe Domain Sequences for d1ndsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndsc2 b.6.1.3 (C:167-340) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} gaalaydrvytigesdlyvpkaadgnysdypalasayadtvavmrtltpshavfngavga ltganaltaavgesvliihsqanrdsrphligghgdwvwttgkfanppqlnmetwfipgg saaaalytfkqpgtyaylshnlieamelgaaaqasvegqwdddlmtsvaapgpa
Timeline for d1ndsc2:
View in 3D Domains from other chains: (mouse over for more information) d1ndsa1, d1ndsa2, d1ndsb1, d1ndsb2 |