SCOPe 2.05: Domain d2pmqa1: 2pmq A:2-125

Lineage for d2pmqa1 (2pmq A:2-125)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Roseovarius sp. [TaxId:314265] [231163] (1 PDB entry)

8. Domain d2pmqa1: 2pmq A:2-125 [231164]
   Other proteins in same PDB: d2pmqa2, d2pmqb2
   automated match to d4mggf1
   complexed with mg

Details for d2pmqa1

PDB Entry: 2pmq, 1.72 Å

PDB Description: crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pmqa1:

Sequence; same for both SEQRES and ATOM records:

>d2pmqa1 d.54.1.0 (A:2-125) automated matches {Roseovarius sp. [TaxId: 314265]}
kiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeaha
ggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhe
llgg

Timeline for d2pmqa1:

• d2pmqa1 first appeared in SCOPe 2.03
  
• d2pmqa1 appears in SCOPe 2.04
  
• d2pmqa1 appears in SCOPe 2.06
  
• d2pmqa1 appears in the current release, SCOPe 2.08