Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Roseovarius sp. [TaxId:314265] [231163] (1 PDB entry) |
Domain d2pmqa1: 2pmq A:2-125 [231164] Other proteins in same PDB: d2pmqa2, d2pmqb2 automated match to d4mggf1 complexed with mg |
PDB Entry: 2pmq (more details), 1.72 Å
SCOPe Domain Sequences for d2pmqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmqa1 d.54.1.0 (A:2-125) automated matches {Roseovarius sp. [TaxId: 314265]} kiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeaha ggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhe llgg
Timeline for d2pmqa1: