Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [230698] (7 PDB entries) |
Domain d2pmha1: 2pmh A:1-60 [231161] Other proteins in same PDB: d2pmha2 automated match to d2cyya1 complexed with gln, mg, na |
PDB Entry: 2pmh (more details), 1.9 Å
SCOPe Domain Sequences for d2pmha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmha1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 273063]} mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
Timeline for d2pmha1: