Lineage for d2pgwd1 (2pgw D:4-131)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413276Species Sinorhizobium meliloti [TaxId:266834] [231146] (1 PDB entry)
  8. 1413280Domain d2pgwd1: 2pgw D:4-131 [231152]
    Other proteins in same PDB: d2pgwa2, d2pgwb2, d2pgwc2, d2pgwd2, d2pgwe2
    automated match to d4mggf1
    complexed with gol

Details for d2pgwd1

PDB Entry: 2pgw (more details), 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021
PDB Compounds: (D:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgwd1 d.54.1.0 (D:4-131) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
pvhqllgg

SCOPe Domain Coordinates for d2pgwd1:

Click to download the PDB-style file with coordinates for d2pgwd1.
(The format of our PDB-style files is described here.)

Timeline for d2pgwd1: