SCOPe 2.03: Domain d2pgwa1: 2pgw A:4-131

Lineage for d2pgwa1 (2pgw A:4-131)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [231146] (1 PDB entry)

8. Domain d2pgwa1: 2pgw A:4-131 [231150]
   Other proteins in same PDB: d2pgwa2, d2pgwb2, d2pgwc2, d2pgwd2, d2pgwe2
   automated match to d4mggf1
   complexed with gol

Details for d2pgwa1

PDB Entry: 2pgw, 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwa1:

Sequence; same for both SEQRES and ATOM records:

>d2pgwa1 d.54.1.0 (A:4-131) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
pvhqllgg

Timeline for d2pgwa1:

• d2pgwa1 is new in SCOPe 2.03-stable
  
• d2pgwa1 appears in SCOPe 2.04
  
• d2pgwa1 appears in the current release, SCOPe 2.08