Lineage for d2p4qa1 (2p4q A:1-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846158Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (5 PDB entries)
  8. 2846163Domain d2p4qa1: 2p4q A:1-175 [231115]
    Other proteins in same PDB: d2p4qa2
    automated match to d2pgda2
    complexed with flc

Details for d2p4qa1

PDB Entry: 2p4q (more details), 2.37 Å

PDB Description: Crystal Structure Analysis of Gnd1 in Saccharomyces cerevisiae
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating 1

SCOPe Domain Sequences for d2p4qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4qa1 c.2.1.0 (A:1-175) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msadfgliglavmgqnlilnaadhgftvcaynrtqskvdhflaneakgksiigatsiedf
isklkrprkvmllvkagapvdalinqivpllekgdiiidggnshfpdsnrryeelkkkgi
lfvgsgvsggeegarygpslmpggseeawphiknifqsisaksdgepccewvgpa

SCOPe Domain Coordinates for d2p4qa1:

Click to download the PDB-style file with coordinates for d2p4qa1.
(The format of our PDB-style files is described here.)

Timeline for d2p4qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p4qa2