SCOPe 2.03: Domain d2orda_: 2ord A:

Lineage for d2orda_ (2ord A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [230690] (2 PDB entries)

8. Domain d2orda_: 2ord A: [231103]
   automated match to d3nx3a_
   complexed with gol, plp

Details for d2orda_

PDB Entry: 2ord, 1.4 Å

PDB Description: crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution

PDB Compounds: (A:) Acetylornithine aminotransferase

SCOPe Domain Sequences for d2orda_:

Sequence; same for both SEQRES and ATOM records:

>d2orda_ c.67.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
kihhhhhhmylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlvea
ikdqaeklihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkk
sekkyrilsahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedv
cavflepiqgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvv
pdvlttakglgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfl
eeveekgnylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvp
agnntirflppltveygeidlavetlkkvlqgi

Timeline for d2orda_:

• d2orda_ is new in SCOPe 2.03-stable
  
• d2orda_ appears in SCOPe 2.04
  
• d2orda_ appears in the current release, SCOPe 2.08, called d2orda1