SCOPe 2.05: Domain d2or8a_: 2or8 A:

Lineage for d2or8a_ (2or8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d2or8a_: 2or8 A: [231101]
   automated match to d2oypa_
   complexed with act

Details for d2or8a_

PDB Entry: 2or8, 2.5 Å

PDB Description: Tim-1

PDB Compounds: (A:) Hepatitis A virus cellular receptor 1 homolog

SCOPe Domain Sequences for d2or8a_:

Sequence; same for both SEQRES and ATOM records:

>d2or8a_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdsyvevkgvvghpvtlpctystyrgitttcwgrgqcpssacqntliwtnghrvtyqkss
rynlkghisegdvsltiensvesdsglyccrveipgwfndqkvtfslqvkpelvpr

Timeline for d2or8a_:

• d2or8a_ first appeared in SCOPe 2.03
  
• d2or8a_ appears in SCOPe 2.04
  
• d2or8a_ is called d2or8a1 in SCOPe 2.06
  
• d2or8a_ appears in the current release, SCOPe 2.08, called d2or8a1