Lineage for d1bq5_1 (1bq5 8-159)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) Protein Nitrite reductase, NIR [49551] (3 species) 
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (4 PDB entries) 
Domain d1bq5_1: 1bq5 8-159 [23110]
Details for d1bq5_1
PDB Entry: 1bq5 (more details), 2.05 Å
PDB Description: nitrite reductase from alcaligenes xylosoxidans gifu 1051
SCOP Domain Sequences for d1bq5_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bq5_1 b.6.1.3 (8-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlpr
SCOP Domain Coordinates for d1bq5_1:
Click to download the PDB-style file with coordinates for d1bq5_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bq5_1:
- d1bq5_1 appears in SCOP 1.57
- d1bq5_1 appears in the current release, SCOPe 2.08, called d1bq5a1
View in 3D
