SCOPe 2.05: Domain d1ndta1: 1ndt A:1-159

Lineage for d1ndta1 (1ndt A:1-159)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (23 PDB entries)
   Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601

8. Domain d1ndta1: 1ndt A:1-159 [23108]
   complexed with cl, cu

Details for d1ndta1

PDB Entry: 1ndt, 2.1 Å

PDB Description: nitrite reductase from alcaligenes xylosoxidans

PDB Compounds: (A:) protein (nitrite reductase)

SCOPe Domain Sequences for d1ndta1:

Sequence; same for both SEQRES and ATOM records:

>d1ndta1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
adadslphtkvtlvappqvhpheqatasgpkvteftmtieekkmviddsgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapsgmvpwhvvsgmsgtlmvlprdglkdp

Timeline for d1ndta1:

• d1ndta1 first appeared (with stable ids) in SCOP 1.55
  
• d1ndta1 appears in SCOPe 2.04
  
• d1ndta1 appears in SCOPe 2.06
  
• d1ndta1 appears in the current release, SCOPe 2.08