SCOPe 2.08: Domain d2oemb2: 2oem B:121-413

Lineage for d2oemb2 (2oem B:121-413)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.0: automated matches [227297] (1 protein)
   not a true family

6. Protein automated matches [227123] (9 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [231052] (4 PDB entries)

8. Domain d2oemb2: 2oem B:121-413 [231060]
   Other proteins in same PDB: d2oema1, d2oemb1
   automated match to d4nasa2
   complexed with 1ae, mg

Details for d2oemb2

PDB Entry: 2oem, 1.7 Å

PDB Description: Crystal structure of a rubisco-like protein from Geobacillus kaustophilus liganded with Mg2+ and 2,3-diketohexane 1-phosphate

PDB Compounds: (B:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2oemb2:

Sequence; same for both SEQRES and ATOM records:

>d2oemb2 c.1.14.0 (B:121-413) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltselkkqalggvdlvkddeilfd
sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv
faygldvlqalredeeiavpimahpafsgavtpsefygvapslwlgkllrlagadfvlfp
spygsvalereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagg
gihghpdgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea

Timeline for d2oemb2:

• d2oemb2 first appeared in SCOPe 2.03
  
• d2oemb2 appears in SCOPe 2.07