Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.0: automated matches [227297] (1 protein) not a true family |
Protein automated matches [227123] (9 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [231052] (4 PDB entries) |
Domain d2oejb2: 2oej B:121-413 [231057] Other proteins in same PDB: d2oeja1, d2oejb1 automated match to d4nasa2 complexed with po4; mutant |
PDB Entry: 2oej (more details), 2.55 Å
SCOPe Domain Sequences for d2oejb2:
Sequence, based on SEQRES records: (download)
>d2oejb2 c.1.14.0 (B:121-413) automated matches {Geobacillus kaustophilus [TaxId: 1462]} pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltpelkkqalggvdlvkddeilfd sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv faygldvlqalredeeiavpimahpvfsgavtpsefygvapslwlgkllrlagadfvlfp spygsvasereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagg gihghphgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea
>d2oejb2 c.1.14.0 (B:121-413) automated matches {Geobacillus kaustophilus [TaxId: 1462]} pgprfgidgirdrvgvhnrpllmsifkgmigrdlayltpelkkqalggvdlvkddeilfd sellpfekritegkaalqevyeqtgkrtlyavnltgktfalkdkakraaelgadvllfnv faygldvlqalredeeiavpimahpvfsgavtpsefygvapslwlgkllrlagadfvlfp spyereqalgiaraltddqepfarafpvpsagihpglvpliirdfgldtivnagggihgh phgaigggrafraaidavlagrplraaaaenealqkaidrwgvvevea
Timeline for d2oejb2: