Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (18 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [231016] (3 PDB entries) |
Domain d2ohjb1: 2ohj B:1-254 [231028] Other proteins in same PDB: d2ohja2, d2ohjb2, d2ohjd2, d2ohje2 automated match to d1ycfa2 complexed with cl, fe, fmn |
PDB Entry: 2ohj (more details), 2.26 Å
SCOPe Domain Sequences for d2ohjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohjb1 d.157.1.0 (B:1-254) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp mkiieaytgwatgm
Timeline for d2ohjb1: