Lineage for d2ohii1 (2ohi I:1-254)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231827Species Methanothermobacter thermautotrophicus [TaxId:145262] [231016] (3 PDB entries)
  8. 2231842Domain d2ohii1: 2ohi I:1-254 [231027]
    Other proteins in same PDB: d2ohia2, d2ohib2, d2ohid2, d2ohie2, d2ohig2, d2ohih2, d2ohii2, d2ohij2
    automated match to d1ycfa2
    complexed with cl, fe, fmn

Details for d2ohii1

PDB Entry: 2ohi (more details), 2.3 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, reduced state
PDB Compounds: (I:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohii1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohii1 d.157.1.0 (I:1-254) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mkaaakrisdgvywtgvldwdlrnyhgytlqgttynaylvcgdegvalidnsypgtfdel
marvedalqqvgmervdyiiqnhvekdhsgvlvelhrrfpeapiyctevavkgllkhyps
lreaefmtvktgdvldlggktltfletpllhwpdsmftlldedgilfsndafgqhlccpq
rldreipeyilmdaarkfyanlitplsklvlkkfdevkelglleriqmiapshgqiwtdp
mkiieaytgwatgm

SCOPe Domain Coordinates for d2ohii1:

Click to download the PDB-style file with coordinates for d2ohii1.
(The format of our PDB-style files is described here.)

Timeline for d2ohii1: