Lineage for d2ohdd_ (2ohd D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954453Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2954459Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 2954460Protein automated matches [190706] (6 species)
    not a true protein
  7. 2954476Species Sulfolobus tokodaii [TaxId:273063] [231009] (1 PDB entry)
  8. 2954480Domain d2ohdd_: 2ohd D: [231013]
    automated match to d4fdfb_

Details for d2ohdd_

PDB Entry: 2ohd (more details), 2.2 Å

PDB Description: Crystal structure of hypothetical molybdenum cofactor biosynthesis protein C from Sulfolobus tokodaii
PDB Compounds: (D:) Probable molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d2ohdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohdd_ d.58.21.0 (D:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
akivdisskdivlreavvegyiklrketiekiknkevekgdvitvaktagilaakktpel
ipmchpiplefvdveikieeeglrvistvkahyktgvemealtatsvalltiwdmvkkye
kdengqypyteiksirvink

SCOPe Domain Coordinates for d2ohdd_:

Click to download the PDB-style file with coordinates for d2ohdd_.
(The format of our PDB-style files is described here.)

Timeline for d2ohdd_: