Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) |
Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
Protein automated matches [190706] (6 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [231009] (1 PDB entry) |
Domain d2ohdd_: 2ohd D: [231013] automated match to d4fdfb_ |
PDB Entry: 2ohd (more details), 2.2 Å
SCOPe Domain Sequences for d2ohdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohdd_ d.58.21.0 (D:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} akivdisskdivlreavvegyiklrketiekiknkevekgdvitvaktagilaakktpel ipmchpiplefvdveikieeeglrvistvkahyktgvemealtatsvalltiwdmvkkye kdengqypyteiksirvink
Timeline for d2ohdd_: