Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) |
Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
Protein automated matches [190706] (5 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [231009] (1 PDB entry) |
Domain d2ohdb_: 2ohd B: [231011] automated match to d4fdfb_ |
PDB Entry: 2ohd (more details), 2.2 Å
SCOPe Domain Sequences for d2ohdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohdb_ d.58.21.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} akivdisskdivlreavvegyiklrketiekiknkevekgdvitvaktagilaakktpel ipmchpiplefvdveikieeeglrvistvkahyktgvemealtatsvalltiwdmvkkye kdengqypyteiksirvin
Timeline for d2ohdb_: