SCOPe 2.08: Domain d2obaa1: 2oba A:2-118

Lineage for d2obaa1 (2oba A:2-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (16 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [230992] (2 PDB entries)

8. Domain d2obaa1: 2oba A:2-118 [230994]
   Other proteins in same PDB: d2obaa2, d2obab2, d2obac2, d2obad2, d2obae2, d2obaf2
   automated match to d3i2ba_
   complexed with zn

Details for d2obaa1

PDB Entry: 2oba, 2.33 Å

PDB Description: pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase

PDB Compounds: (A:) Probable 6-pyruvoyl tetrahydrobiopterin synthase

SCOPe Domain Sequences for d2obaa1:

Sequence; same for both SEQRES and ATOM records:

>d2obaa1 d.96.1.0 (A:2-118) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
elfkeftfesahrlphvpeghkcgrlhghsfrvaihiegevdphtgwirdfaeikaifkp
iyeqldhnylndipglenptsenlcrwiwqqlkpllpelskvrvhetctsgceyrgd

Timeline for d2obaa1:

• d2obaa1 first appeared in SCOPe 2.03, called d2obaa_
  
• d2obaa1 appears in SCOPe 2.07