SCOPe 2.05: Domain d2nqdb_: 2nqd B:

Lineage for d2nqdb_ (2nqd B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)

8. Domain d2nqdb_: 2nqd B: [230974]
   Other proteins in same PDB: d2nqda_
   automated match to d3of8a_
   complexed with cl, na

Details for d2nqdb_

PDB Entry: 2nqd, 1.75 Å

PDB Description: crystal structure of cysteine protease inhibitor, chagasin, in complex with human cathepsin l

PDB Compounds: (B:) Cathepsin L

SCOPe Domain Sequences for d2nqdb_:

Sequence; same for both SEQRES and ATOM records:

>d2nqdb_ d.3.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaprsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgp
qgnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqe
kalmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdn
nkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d2nqdb_:

• d2nqdb_ first appeared in SCOPe 2.03
  
• d2nqdb_ appears in SCOPe 2.04
  
• d2nqdb_ appears in SCOPe 2.06
  
• d2nqdb_ appears in the current release, SCOPe 2.08