Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Dengue virus 4 [TaxId:408688] [230938] (4 PDB entries) |
Domain d2jlxa2: 2jlx A:483-618 [230952] Other proteins in same PDB: d2jlxa1, d2jlxb1 automated match to d2bhra1 protein/RNA complex; complexed with adp, cl, mn, vo4 |
PDB Entry: 2jlx (more details), 2.2 Å
SCOPe Domain Sequences for d2jlxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jlxa2 c.37.1.0 (A:483-618) automated matches {Dengue virus 4 [TaxId: 408688]} edhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfvelmrrgdl pvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkwldarvya dpmalkdfkefasgrk
Timeline for d2jlxa2: