Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (7 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein automated matches [226986] (8 species) not a true protein |
Species Dengue virus 4 [TaxId:408688] [230921] (9 PDB entries) |
Domain d2jlub1: 2jlu B:172-482 [230925] Other proteins in same PDB: d2jlua2, d2jlub2 automated match to d2bhra2 protein/RNA complex; complexed with gol |
PDB Entry: 2jlu (more details), 2.04 Å
SCOPe Domain Sequences for d2jlub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jlub1 c.37.1.14 (B:172-482) automated matches {Dengue virus 4 [TaxId: 408688]} gepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvvaaem eealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeahftdp csvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntgfdwi tdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvttdis emganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaqeddq yvfsgdplknd
Timeline for d2jlub1: