Lineage for d2jk1a_ (2jk1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356554Species Rhodobacter capsulatus [TaxId:1061] [225556] (3 PDB entries)
  8. 1356555Domain d2jk1a_: 2jk1 A: [230917]
    automated match to d2vuib_
    complexed with mg

Details for d2jk1a_

PDB Entry: 2jk1 (more details), 2.1 Å

PDB Description: crystal structure of the wild-type hupr receiver domain
PDB Compounds: (A:) hydrogenase transcriptional regulatory protein hupr1

SCOPe Domain Sequences for d2jk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jk1a_ c.23.1.0 (A:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
paillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviicdqrmpgrtgvd
fltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmft
larenerlslemrllerp

SCOPe Domain Coordinates for d2jk1a_:

Click to download the PDB-style file with coordinates for d2jk1a_.
(The format of our PDB-style files is described here.)

Timeline for d2jk1a_: