Lineage for d2jd4a1 (2jd4 A:2678-2872)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308996Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 1309004Domain d2jd4a1: 2jd4 A:2678-2872 [230907]
    automated match to d1dyka1

Details for d2jd4a1

PDB Entry: 2jd4 (more details), 1.9 Å

PDB Description: mouse laminin alpha1 chain, domains lg4-5
PDB Compounds: (A:) laminin subunit alpha-1

SCOPe Domain Sequences for d2jd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd4a1 b.29.1.0 (A:2678-2872) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aplaqpelcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgli
yyvahqnqmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmt
vdgqespsvtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqld
kdrplsasavdrcyv

SCOPe Domain Coordinates for d2jd4a1:

Click to download the PDB-style file with coordinates for d2jd4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jd4a1: