Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries) |
Domain d2jd4a1: 2jd4 A:2678-2872 [230907] automated match to d1dyka1 |
PDB Entry: 2jd4 (more details), 1.9 Å
SCOPe Domain Sequences for d2jd4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd4a1 b.29.1.0 (A:2678-2872) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aplaqpelcavdtapgyvagahqfglsqnshlvlplqqsdvrkrlqvqlsirtfassgli yyvahqnqmdyatlqlqegrlhfmfdlgkgrtkvshpallsdgkwhtvkteyikrkafmt vdgqespsvtvvgkattldverklylgglpshyrarnigtithsipacigeimvngqqld kdrplsasavdrcyv
Timeline for d2jd4a1: