Lineage for d1as6a1 (1as6 A:5-166)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56231Protein Nitrite reductase, NIR [49551] (3 species)
  7. 56255Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (13 PDB entries)
  8. 56292Domain d1as6a1: 1as6 A:5-166 [23090]

Details for d1as6a1

PDB Entry: 1as6 (more details), 2 Å

PDB Description: structure of nitrite bound to oxidized alcaligenes faecalis nitrite reductase at cryo temperature

SCOP Domain Sequences for d1as6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as6a1 b.6.1.3 (A:5-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOP Domain Coordinates for d1as6a1:

Click to download the PDB-style file with coordinates for d1as6a1.
(The format of our PDB-style files is described here.)

Timeline for d1as6a1: