![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (9 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [230888] (3 PDB entries) |
![]() | Domain d2j3zc2: 2j3z C:218-429 [230894] automated match to d1giqa2 complexed with co, gol, so4 |
PDB Entry: 2j3z (more details), 2.3 Å
SCOPe Domain Sequences for d2j3zc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j3zc2 d.166.1.0 (C:218-429) automated matches {Clostridium botulinum [TaxId: 1491]} eldfynkgseawgaenygdyisklsheqlgalegylhsdykainsylrnnrvpnndelnk kielissalsvkpipqtliayrrvdgipfdlpsdfsfdkkengeiiadkqklnefidkwt gkeienlsfsstslkstpssfsksrfifrlrlsegaigafiygfsgfqdeqeillnknst fkifritpitsiinrvtkmtqvvidaegiqnk
Timeline for d2j3zc2: