Class a: All alpha proteins [46456] (284 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
Protein automated matches [226884] (5 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [230884] (1 PDB entry) |
Domain d2j1qa1: 2j1q A:1-95 [230885] Other proteins in same PDB: d2j1qa2 automated match to d1m15a1 complexed with gol |
PDB Entry: 2j1q (more details), 1.9 Å
SCOPe Domain Sequences for d2j1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1qa1 a.83.1.0 (A:1-95) automated matches {Trypanosoma cruzi [TaxId: 5693]} masaevvskleaafaklqnasdchsllkkyltkevfdqlkgkqtkmgatlmdviqsgven ldsgigvyapdaesytlfaalldpiiedyhkgfkp
Timeline for d2j1qa1: