Lineage for d2j1pa_ (2j1p A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. Species Sinapis alba [TaxId:3728] [230881] (1 PDB entry)
  8. 1282302Domain d2j1pa_: 2j1p A: [230882]
    automated match to d3oacd_

Details for d2j1pa_

PDB Entry: 2j1p (more details), 1.8 Å

PDB Description: geranylgeranyl diphosphate synthase from sinapis alba in complex with ggpp
PDB Compounds: (A:) Geranylgeranyl pyrophosphate synthetase

SCOPe Domain Sequences for d2j1pa_:

Sequence, based on SEQRES records: (download)

>d2j1pa_ a.128.1.0 (A:) automated matches {Sinapis alba [TaxId: 3728]}
pisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvggees
lampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavlagdallsfafeh
lasatssevsparvvravgelakaigteglvagqvvdissegldlnnvglehlkfihlhk
taalleasavlggiigggsdeeierlrkfarcigllfqvvddildvtksskltypklmgl
eksrefaeklnteardqllgfdsdkvapllalanyianrqn

Sequence, based on observed residues (ATOM records): (download)

>d2j1pa_ a.128.1.0 (A:) automated matches {Sinapis alba [TaxId: 3728]}
pisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvggees
lampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavlagdallsfafeh
lasatssevsparvvravgelakaigteglvagqvvdisldlnnvglehlkfihlhktaa
lleasavlggiigggsdeeierlrkfarcigllfqvvddildvtkkltypklmgleksre
faeklnteardqllgfdsdkvapllalanyianrqn

SCOPe Domain Coordinates for d2j1pa_:

Click to download the PDB-style file with coordinates for d2j1pa_.
(The format of our PDB-style files is described here.)

Timeline for d2j1pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j1pb_