SCOP 1.71: Domain d1ntd_1: 1ntd 5-166

Lineage for d1ntd_1 (1ntd 5-166)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries)

8. Domain d1ntd_1: 1ntd 5-166 [23088]

Details for d1ntd_1

PDB Entry: 1ntd, 2 Å

PDB Description: structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc

SCOP Domain Sequences for d1ntd_1:

Sequence; same for both SEQRES and ATOM records:

>d1ntd_1 b.6.1.3 (5-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgengaimvlpreglhdgk

Timeline for d1ntd_1:

• d1ntd_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ntd_1 appears in SCOP 1.69
  
• d1ntd_1 is called d1ntda1 in SCOP 1.73
  
• d1ntd_1 appears in the current release, SCOPe 2.08, called d1ntda1