Lineage for d2izzd1 (2izz D:-4-164)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580813Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries)
  8. 1580831Domain d2izzd1: 2izz D:-4-164 [230877]
    Other proteins in same PDB: d2izza2, d2izzb2, d2izzc2, d2izzd2, d2izze2
    automated match to d2rcyd1
    complexed with edo, nad

Details for d2izzd1

PDB Entry: 2izz (more details), 1.95 Å

PDB Description: crystal structure of human pyrroline-5-carboxylate reductase
PDB Compounds: (D:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2izzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izzd1 c.2.1.0 (D:-4-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltph
nketvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpap
rvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

SCOPe Domain Coordinates for d2izzd1:

Click to download the PDB-style file with coordinates for d2izzd1.
(The format of our PDB-style files is described here.)

Timeline for d2izzd1: