Lineage for d1et5a1 (1et5 A:4-166)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) Protein Nitrite reductase, NIR [49551] (3 species) 
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (9 PDB entries) 
Domain d1et5a1: 1et5 A:4-166 [23080]
Details for d1et5a1
PDB Entry: 1et5 (more details), 1.9 Å
PDB Description: crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6
SCOP Domain Sequences for d1et5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1et5a1 b.6.1.3 (A:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
SCOP Domain Coordinates for d1et5a1:
Click to download the PDB-style file with coordinates for d1et5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1et5a1:
- d1et5a1 appears in SCOP 1.57
- d1et5a1 appears in the current release, SCOPe 2.08
View in 3D
