Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [225152] (1 PDB entry) |
Domain d2i79b_: 2i79 B: [230781] automated match to d2i79d_ complexed with aco |
PDB Entry: 2i79 (more details), 2.1 Å
SCOPe Domain Sequences for d2i79b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i79b_ d.108.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} meyellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqi tllaflngkiagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgi lrrlqltvqtrnqaavhlyqkhgfviegsqergayieegkfidvylmgkli
Timeline for d2i79b_: