SCOPe 2.06: Domain d2hjva_: 2hjv A:

Lineage for d2hjva_ (2hjv A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [230763] (2 PDB entries)

8. Domain d2hjva_: 2hjv A: [230765]
   automated match to d2rb4a_

Details for d2hjva_

PDB Entry: 2hjv, 1.95 Å

PDB Description: Structure of the second domain (residues 207-368) of the Bacillus subtilis YxiN protein

PDB Compounds: (A:) ATP-dependent RNA helicase dbpA

SCOPe Domain Sequences for d2hjva_:

Sequence; same for both SEQRES and ATOM records:

>d2hjva_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
ttrniehaviqvreenkfsllkdvlmtenpdsciifcrtkehvnqltdelddlgypcdki
hggmiqedrfdvmnefkrgeyrylvatdvaargidienislvinydlplekesyvhrtgr
tgragnkgkaisfvtafekrfladieeyigfeiqkiea

Timeline for d2hjva_:

• d2hjva_ first appeared in SCOPe 2.03
  
• d2hjva_ appears in SCOPe 2.05
  
• d2hjva_ appears in SCOPe 2.07
  
• d2hjva_ appears in the current release, SCOPe 2.08