Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries) |
Domain d2h4va1: 2h4v A:831-1122 [230759] Other proteins in same PDB: d2h4va2, d2h4vb2 automated match to d3qcea_ complexed with act, cl, edo, flc, na |
PDB Entry: 2h4v (more details), 1.55 Å
SCOPe Domain Sequences for d2h4va1:
Sequence, based on SEQRES records: (download)
>d2h4va1 c.45.1.0 (A:831-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhknryinilaydhsr vklrplpgkdskhsdyinanyvdgynkakayiatqgplkstfedfwrmiweqntgiivmi tnlvekgrrkcdqywptenseeygniivtlkstkihacytvrrfsirntkvkkgqkgnpk grqnervviqyhytqwpdmgvpeyalpvltfvrrssaarmpetgpvlvhcsagvgrtgty ividsmlqqikdkstvnvlgflkhirtqrnylvqteeqyifihdalleailg
>d2h4va1 c.45.1.0 (A:831-1122) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhknryinilaydhsr vklrplphsdyinanyvdgynkakayiatqgplkstfedfwrmiweqntgiivmitnlve kgrrkcdqywptenseeygniivtlkstkihacytvrrfsirntkervviqyhytqwpdm gvpeyalpvltfvrrssaarmpetgpvlvhcsagvgrtgtyividsmlqqikdkstvnvl gflkhirtqrnylvqteeqyifihdalleailg
Timeline for d2h4va1: