Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Plasmodium yoelii [TaxId:352914] [225071] (1 PDB entry) |
Domain d2ghia_: 2ghi A: [230749] automated match to d2ghid_ complexed with so4 |
PDB Entry: 2ghi (more details), 2.2 Å
SCOPe Domain Sequences for d2ghia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghia_ c.37.1.0 (A:) automated matches {Plasmodium yoelii [TaxId: 352914]} lesfsltshekkfgvniefsdvnfsypkqtnhrtlksinffipsgttcalvghtgsgkst iakllyrfydaegdikiggknvnkynrnsirsiigivpqdtilfnetikynilygkldat deevikatksaqlydfiealpkkwdtivgnkgmklsggerqriaiarcllkdpkivifde atssldskteylfqkavedlrknrtliiiahrlstissaesiillnkgkivekgthkdll klngeyaemwnmqsg
Timeline for d2ghia_: