Lineage for d2ghia_ (2ghi A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366510Species Plasmodium yoelii [TaxId:352914] [225071] (1 PDB entry)
  8. 1366511Domain d2ghia_: 2ghi A: [230749]
    automated match to d2ghid_
    complexed with so4

Details for d2ghia_

PDB Entry: 2ghi (more details), 2.2 Å

PDB Description: crystal structure of plasmodium yoelii multidrug resistance protein 2
PDB Compounds: (A:) transport protein

SCOPe Domain Sequences for d2ghia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghia_ c.37.1.0 (A:) automated matches {Plasmodium yoelii [TaxId: 352914]}
lesfsltshekkfgvniefsdvnfsypkqtnhrtlksinffipsgttcalvghtgsgkst
iakllyrfydaegdikiggknvnkynrnsirsiigivpqdtilfnetikynilygkldat
deevikatksaqlydfiealpkkwdtivgnkgmklsggerqriaiarcllkdpkivifde
atssldskteylfqkavedlrknrtliiiahrlstissaesiillnkgkivekgthkdll
klngeyaemwnmqsg

SCOPe Domain Coordinates for d2ghia_:

Click to download the PDB-style file with coordinates for d2ghia_.
(The format of our PDB-style files is described here.)

Timeline for d2ghia_: