SCOPe 2.04: Domain d2gf2a2: 2gf2 A:202-335

Lineage for d2gf2a2 (2gf2 A:202-335)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)

8. Domain d2gf2a2: 2gf2 A:202-335 [230745]
   Other proteins in same PDB: d2gf2a1, d2gf2b1, d2gf2c1, d2gf2d1
   automated match to d2gf2b2

Details for d2gf2a2

PDB Entry: 2gf2, 2.38 Å

PDB Description: Crystal structure of human hydroxyisobutyrate dehydrogenase

PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2gf2a2:

Sequence; same for both SEQRES and ATOM records:

>d2gf2a2 a.100.1.0 (A:202-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp
gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk
dfssvfqflreeet

Timeline for d2gf2a2:

• d2gf2a2 first appeared in SCOPe 2.03
  
• d2gf2a2 appears in SCOPe 2.05
  
• d2gf2a2 appears in the current release, SCOPe 2.08