SCOPe 2.03: Domain d2gf2a1: 2gf2 A:40-201

Lineage for d2gf2a1 (2gf2 A:40-201)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)

8. Domain d2gf2a1: 2gf2 A:40-201 [230744]
   Other proteins in same PDB: d2gf2a2, d2gf2b2, d2gf2c2, d2gf2d2
   automated match to d2gf2b1

Details for d2gf2a1

PDB Entry: 2gf2, 2.38 Å

PDB Description: Crystal structure of human hydroxyisobutyrate dehydrogenase

PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2gf2a1:

Sequence; same for both SEQRES and ATOM records:

>d2gf2a1 c.2.1.0 (A:40-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycga

Timeline for d2gf2a1:

• d2gf2a1 is new in SCOPe 2.03-stable
  
• d2gf2a1 appears in SCOPe 2.04
  
• d2gf2a1 appears in the current release, SCOPe 2.08